PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.004G126000.1
Common NamePHAVU_004G126000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 226aa    MW: 26447.2 Da    PI: 8.9259
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.004G126000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.72e-1182125347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          WT eE+ l++++   +G g Wk+I+ +++ ++ + q+ s+ qky
  Phvul.004G126000.1  82 TWTMEEHRLFLEGLYIYGRGYWKKISYYIQ-TKDATQVASHAQKY 125
                         7*****************************.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-872128IPR009057Homeodomain-like
PROSITE profilePS5129411.45375130IPR017930Myb domain
SuperFamilySSF466892.15E-1477128IPR009057Homeodomain-like
SMARTSM007172.4E-679128IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.2E-1379128IPR006447Myb domain, plants
PfamPF002491.2E-982125IPR001005SANT/Myb domain
CDDcd001676.54E-782126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MEVLSEEWWN ETNALFLEVF PNIQTQTATS DKINGPPIML SLPETTLLSG HPHQDIVEAP  60
LVLAPSQTCR IQVQSNKRKR ITWTMEEHRL FLEGLYIYGR GYWKKISYYI QTKDATQVAS  120
HAQKYFMRNN ISQEKKKRKS IHDMVLSQPI QVHFNPPINM SHPEHLNPVN MSHQIPPITE  180
MMQSNHINHI NHHPQYNGIH QMMESNSINN VVYSTQFHQM QSRWR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007152391.11e-168hypothetical protein PHAVU_004G126000g
TrEMBLV7C5281e-168V7C528_PHAVU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.12e-20MYB family protein